PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016493379.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family B3
Protein Properties Length: 408aa    MW: 46658 Da    PI: 7.3676
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016493379.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B347.72.7e-1560142490
                     E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
              B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90 
                      +++s+  ++g l lpk+fa ++++ + ++  l+++des r W+++l    +++r+ + + WkeF  an+Lk+g+ ++F+++++  +
  XP_016493379.1  60 CTVRSYWVSNGYLFLPKQFALANSLTN-KNCGLIIRDESQRPWNLRL--ATYRSRVCIVGRWKEFIVANDLKVGECIMFEVVNNG-E 142
                     56789999***************5543.33469**************..99999**************************88753.3 PP

2B351.81.4e-16182262588
                     -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSS CS
              B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrs 88 
                     +++++ l++g l+lp +fa+++g+ + ++  l++ de+ r+W+++l    +++++ + +GW+eF  an+Lk+gD ++F+++ + 
  XP_016493379.1 182 TVKPYFLTKGYLRLPMQFARANGLTN-KNCGLIISDETQRRWNLRL--ATYGSQVCIVGGWNEFHAANDLKVGDCIMFEVVTNG 262
                     5679999***************7664.4457999************..999999*************************87643 PP

3B359.84.9e-19303386592
                     -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE.. CS
              B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefel 92 
                     ++++++l++++l++pk+fa ++g+ + ++ +l+++de  rsW+v+l  +  ++++++++GW eF +a+ LkegD ++F+l+ + + ++
  XP_016493379.1 303 TVRPYYLSNDLLYIPKQFALANGLTN-KKCDLIIRDELQRSWNVRL--CSFGNSVFIRGGWHEFRNAKCLKEGDCIMFELVTN-GNRP 386
                     67899*****************8885.4569***************..888888*************************9874.4444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.106.7E-1555148IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.75857151IPR003340B3 DNA binding domain
SuperFamilySSF1019369.02E-1857149IPR015300DNA-binding pseudobarrel domain
SMARTSM010191.6E-957152IPR003340B3 DNA binding domain
PfamPF023625.2E-1360144IPR003340B3 DNA binding domain
CDDcd100171.79E-1263151No hitNo description
Gene3DG3DSA:2.40.330.101.8E-16174267IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.92E-17177269IPR015300DNA-binding pseudobarrel domain
SMARTSM010197.5E-12178273IPR003340B3 DNA binding domain
PROSITE profilePS5086312.788178272IPR003340B3 DNA binding domain
PfamPF023624.7E-14182264IPR003340B3 DNA binding domain
CDDcd100173.39E-12188257No hitNo description
Gene3DG3DSA:2.40.330.101.4E-21297391IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.71E-21298392IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.858299393IPR003340B3 DNA binding domain
CDDcd100173.52E-16299390No hitNo description
SMARTSM010195.8E-19300394IPR003340B3 DNA binding domain
PfamPF023623.0E-17302388IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 408 aa     Download sequence    Send to blast
MLVFRHDGNM EFEVVIFDSS HCDREYAENL QEEEEEEEEG RGGEEEQGEE ANFGQSLFEC  60
TVRSYWVSNG YLFLPKQFAL ANSLTNKNCG LIIRDESQRP WNLRLATYRS RVCIVGRWKE  120
FIVANDLKVG ECIMFEVVNN GEKPIWQFHV KPNPIIMSSR KAFPNEESAN HSPSGQSLLL  180
LTVKPYFLTK GYLRLPMQFA RANGLTNKNC GLIISDETQR RWNLRLATYG SQVCIVGGWN  240
EFHAANDLKV GDCIMFEVVT NGDKPIRKFY GKPNPSMKSS SKAFPYAGTD THKPFSRSHF  300
VCTVRPYYLS NDLLYIPKQF ALANGLTNKK CDLIIRDELQ RSWNVRLCSF GNSVFIRGGW  360
HEFRNAKCLK EGDCIMFELV TNGNRPILKF NGKISGEDTN VIQGISEQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009766333.10.0PREDICTED: B3 domain-containing protein REM17-like isoform X2
RefseqXP_016493379.10.0PREDICTED: B3 domain-containing protein REM17-like isoform X2
TrEMBLM1AKH51e-166M1AKH5_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000246761e-165(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26680.16e-27B3 family protein